PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G014100.1
Common NameB456_003G014100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 292aa    MW: 32900.9 Da    PI: 9.2918
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G014100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.85.2e-3357112359
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                          vrY+eClkNhAa++Ggh+vDGCgEfmps geegt+aa+kCaAC+CHRnFHR+e + 
  Gorai.003G014100.1  57 VVRYRECLKNHAATMGGHVVDGCGEFMPS-GEEGTMAAMKCAACECHRNFHRKEING 112
                         589*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2158111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-3058110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-3059110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.45360109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.55E-19167234IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-29169235IPR009057Homeodomain-like
TIGRFAMsTIGR015655.5E-27173230IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MELRDQDKEM GLPLPLSSSQ TPNPRPPQTL NHYPNIDPLP PGSVAGAEPE PVGSSLVVRY  60
RECLKNHAAT MGGHVVDGCG EFMPSGEEGT MAAMKCAACE CHRNFHRKEI NGESQYLPPL  120
PRRNGVVHLQ QQPVRFPAPV MMSFGGGGGG TAEESSSEDL RHDELINVPQ SSKKRFRTKF  180
SQDQKEKMME FAETLGWRIQ KQDEHELQMF CSQVGVKRQV FKVWMHNNKQ AMKKKQMKKK  240
ESSAVTKTKN KSQIYLKMLC CFCWLFTYFP QNSLVLKRGI AMGNVWLSKE V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-221722311675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469414.11e-179PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D2MHX90.0A0A0D2MHX9_G
STRINGPOPTR_0007s12970.16e-73(Populus trichocarpa)
STRINGSolyc02g085160.1.15e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.12e-58homeobox protein 33
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]